PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676719144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27092.4 Da    PI: 5.5
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676719144genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.3e-29959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl+e++s
  676719144  9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCS 59
               68***********************************************96 PP

2K-box531.4e-18921701997
      K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                 ++a+L kei    + +R++ Ge+L+ L++ eLqqLe++Le +l+++ ++K+e ++++i++lq+k  +l +enk+L+++
  676719144  92 SDHARLSKEIADKSHRLRQMRGEELQGLNIDELQQLEKALEAGLTRVIETKSEKIMNEISYLQRKGMQLMDENKRLKQQ 170
                67899******999**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.459161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.49E-40277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-31375IPR002100Transcription factor, MADS-box
PfamPF003194.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.88187180IPR002487Transcription factor, K-box
PfamPF014864.0E-1692170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFEFCSS  60
SMREVLERHN LQSKNLEKLD QPSLELQLVE NSDHARLSKE IADKSHRLRQ MRGEELQGLN  120
IDELQQLEKA LEAGLTRVIE TKSEKIMNEI SYLQRKGMQL MDENKRLKQQ GTQLTEENER  180
LGKQICNNVN ETYGGGESEN TAVYEEGHSS ESITNAGNST GAPVDSESSD TSLRLGLPYG  240
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A5e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D5e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9067150.0JQ906715.1 Brassica juncea clone SVP-1 MADS-box protein SVP (SVP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112514.11e-166PREDICTED: MADS-box protein SVP
SwissprotQ9FVC11e-163SVP_ARATH; MADS-box protein SVP
TrEMBLH9XGX11e-166H9XGX1_BRAJU; Short vegetative phase protein
TrEMBLM4FBP51e-166M4FBP5_BRARP; Uncharacterized protein
TrEMBLQ06AL81e-166Q06AL8_BRARO; Short vegetative phase protein
STRINGBra038511.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-164MIKC_MADS family protein